PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo27G0006600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 352aa    MW: 37961.8 Da    PI: 8.167
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo27G0006600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++++G g+W+++++  g+ R++k+c++rw +yl
  Spipo27G0006600 14 KGLWSPEEDEKLLSHITKHGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.32e-1467109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg ++++E++l++++++ lG++ W+ Ia++++ gRt++++k+ w+
  Spipo27G0006600  67 RGTFSQQEEDLIIELHAALGNR-WSQIAARLP-GRTDNEIKNLWN 109
                      899*******************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-28664IPR009057Homeodomain-like
PROSITE profilePS5129424.863965IPR017930Myb domain
SuperFamilySSF466893.74E-2912108IPR009057Homeodomain-like
SMARTSM007179.5E-131363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
CDDcd001675.43E-121761No hitNo description
Gene3DG3DSA:1.10.10.606.5E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.1766116IPR017930Myb domain
SMARTSM007173.7E-1366114IPR001005SANT/Myb domain
PfamPF002491.7E-1367109IPR001005SANT/Myb domain
CDDcd001671.36E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLSHIT KHGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQQEEDLIIE LHAALGNRWS QIAARLPGRT DNEIKNLWNS SIKKKLRQKG  120
IDPTTHRPLS GTAAEKAPPE EKTSLDDQRP TAPPPSDHAS PLVGGAGKSM AAALTKDSVI  180
DQLNCGSSSS PPPAPTASIG LSASLSPLLL WLSQNSRSSD VFPPAASSVP LPPDSLHSPP  240
PPCNPVNGAH LWDCIRGRGG ADMEFQGSSS SSSLFDSSPL PWPEEELKWP EYLNNTFPAP  300
SAMQSHGVYA AGVDVVRAEG PFQGGVLGTW LQVADVCSRD FQRLSAAFGQ I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008807932.11e-101PREDICTED: myb-related protein Hv33-like
TrEMBLA0A061DSV57e-98A0A061DSV5_THECC; Myb domain protein 55
STRINGSb03g011640.13e-97(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.13e-85myb domain protein 61